Bacterial taxon 223926
Locus VP_0577
Protein BAC58840.1
phosphate transport system regulatory protein PhoU
Vibrio parahaemolyticus RIMD 2210633
Length 232 aa, Gene n/a, UniProt Q87S47
>BAC58840.1|Vibrio parahaemolyticus RIMD 2210633|phosphate transport system regulatory protein PhoU
MHFGRHISGQFNVELESIRTHVLTMGGLVEQQLSYAIQALHKEDIELARKVVRDDHKVNAMEVSIDDACTRIIAKRQPTAKDLRLIMAIIKTITDLERIGDVATRIAYVAIESPSSKERQFQVSLEPLCRQAIQMLHQVLDAFARMDVEAAAEVHKLDDKLDAEYEAVIRQLMTYMMEDPKNIPHILQVMWSARAIERVGDRCQNICEYIIYFVKGKDVRHLGDQSIDDVLK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.82 | 0.034 | ●●●○○ -2.15 | -2.1544478768946385 | 27185914 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)