Bacterial taxon 223926
Locus VP_0685
Protein BAC58948.1
phosphatidylglycerophosphatase A
Vibrio parahaemolyticus RIMD 2210633
Length 168 aa, Gene n/a, UniProt Q87RU1
>BAC58948.1|Vibrio parahaemolyticus RIMD 2210633|phosphatidylglycerophosphatase A
MTNPLSLISLKNPWHLLATGFGSGLSPVVPGTMGTLAAVPFFLLLAQLPFPAYVVVVLLSCVIGIKICQVTSDDMKVHDHGSIVWDEFAGFWITMSIVPALNIPITEWKWLLTGFILFRFFDMVKPWPIGWLDKRIHGGLGIMLDDIVAGIMAGIALFLVAKYAGWMS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.68 | 0.00028 | ●●●●○ -3.77 | -3.7706970500869743 | 27185914 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)