Bacterial taxon 223926
Locus VP_0795
Protein BAC59058.1
phosphocarrier protein HPr
Vibrio parahaemolyticus RIMD 2210633
Length 85 aa, Gene n/a, UniProt Q87RJ9
>BAC59058.1|Vibrio parahaemolyticus RIMD 2210633|phosphocarrier protein HPr
MYEKQVEITAENGLHTRPAAQFVKEAKAFDADITVTSNGKSASAKSLFKLQTLGLVKGTLVTISAEGPQAQQAVDHLVALMDQLH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.14 | 0.0015 | ●●●●○ -3.31 | -3.306141038184398 | 27185914 |
Retrieved 1 of 1 entries in 51 ms
(Link to these results)