Bacterial taxon 223926
Locus VP_2288
Protein BAC60551.1
phosphoheptose isomerase
Vibrio parahaemolyticus RIMD 2210633
Length 191 aa, Gene gmhA, UniProt Q87MG7
>BAC60551.1|Vibrio parahaemolyticus RIMD 2210633|phosphoheptose isomerase
MYQDLIRSELNEAAEVLNKFLSDDHNIAQIEAAAKMIADSFKQDGKVLSCGNGGSHCDAMHFAEELTGRYRDNRPGYAGIAISDPSHLSCVSNDFGYDFVFSRYVEAVGRKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTVALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEME
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -5.18 | 5.0e-5 | ●●●●● -4.21 | -4.20667116687781 | 27185914 |
Retrieved 1 of 1 entries in 25.1 ms
(Link to these results)