Bacterial taxon 223926
Locus VP_2255
Protein BAC60518.1
polar flagellar rod protein FlaI
Vibrio parahaemolyticus RIMD 2210633
Length 101 aa, Gene n/a, UniProt Q87MJ5
>BAC60518.1|Vibrio parahaemolyticus RIMD 2210633|polar flagellar rod protein FlaI
MQNELIEISDIDQLITQELEKVDFNTEEILRLVDIRERLLQNLLPIIQQNPLVKQDAEWQDLLTRTKRIVELMQSETSKVGKELHKFRYGQRSLQQYKKFI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.87 | 0.007 | ○○○○○ 2.79 | 2.7923652764668083 | 27185914 |
Retrieved 1 of 1 entries in 58.2 ms
(Link to these results)