Bacterial taxon 223926
Locus VP_2514
Protein BAC60777.1
putative carbonic anhydrase
Vibrio parahaemolyticus RIMD 2210633
Length 222 aa, Gene n/a, UniProt Q87LU4
>BAC60777.1|Vibrio parahaemolyticus RIMD 2210633|putative carbonic anhydrase
MPEIKQLFENNSKWSEEIKSDRPEYFAKLAEGQKPDFLWIGCSDSRVPAERLTGLYSGELFVHRNVANQVIHTDLNCLSVVQYAVDVLKVKHIIVCGHYGCGGVNAAIDNPQLGLINNWLLHIRDLYFKHRSYLDQMPVEDRADKLGEINVAEQVYNLGNSTIMQNAWERGQDVEIHGVVYGIEDGRLEYLGIRSNSKETVEASYQKALSTILNPDNKLLCR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.79 | 0.0039 | ●●●○○ -3 | -2.9969011163179844 | 27185914 |
Retrieved 1 of 1 entries in 68.3 ms
(Link to these results)