Bacterial taxon 223926
Locus VPA_1363
Protein BAC62706.1
putative chaperone
Vibrio parahaemolyticus RIMD 2210633
Length 96 aa, Gene n/a, UniProt Q87GF3
>BAC62706.1|Vibrio parahaemolyticus RIMD 2210633|putative chaperone
MKLSGTDSSIADWLVQQNTSWSLDSGGQLEFNKDHAGGIPIESLETFFDGFPDRVLSDEELKLLNRIGDNVKMIMQTLKYWTQILRDERVAIAKNI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.75 | 0.0084 | ●●●○○ -2.85 | -2.850228171016367 | 27185914 |
Retrieved 1 of 1 entries in 32.2 ms
(Link to these results)