Bacterial taxon 223926
Locus VP_1317
Protein BAC59580.1
putative glutaredoxin
Vibrio parahaemolyticus RIMD 2210633
Length 76 aa, Gene n/a, UniProt Q87Q33
>BAC59580.1|Vibrio parahaemolyticus RIMD 2210633|putative glutaredoxin
MKRVVLYVKDKCPHCKDAQRYLDSKNINYRLCNAKMQRGRKELDALGARSVPVLKIGDRVMIGWNPKNFEKMYSGS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 4.36 | 8.2e-5 | ○○○○○ 4.09 | 4.088176692996516 | 27185914 |
Retrieved 1 of 1 entries in 23.6 ms
(Link to these results)