Bacterial taxon 223926
Locus VP_2439
Protein BAC60701.1
putative hydrolase
Vibrio parahaemolyticus RIMD 2210633
Length 257 aa, Gene n/a, UniProt Q87M20
>BAC60701.1|Vibrio parahaemolyticus RIMD 2210633|putative hydrolase
MKFFDTHCHFDFEVFQDDFAHQLELAQTQGVARILIPSVGPQNWARIQMLAEQHANLYYALGFHPYFLEDNVEQHLSELERYLNQKSPQCVAIGECGLDFAVNVDPELQERALEIQFELARRFNLPVILHSRKAHNRLIQMVKAAKLPRGGVLHAFAGSYQQGMEWVRLGFFIGVGGTITYPRAHKTRDAIQRLPLENLVIETDAPDMPILGYQGELNHPAKLIHVFNELAELHSVRKQSIATQLWENSNFAFSICE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 3.19 | 0.0032 | ○○○○○ 3.07 | 3.0659342167037757 | 27185914 |
Retrieved 1 of 1 entries in 30.7 ms
(Link to these results)