Bacterial taxon 223926
Locus VPA_1353
Protein BAC62696.1
putative outer membrane protein
Vibrio parahaemolyticus RIMD 2210633
Length 268 aa, Gene n/a, UniProt Q87GG3
>BAC62696.1|Vibrio parahaemolyticus RIMD 2210633|putative outer membrane protein
MKRKKLLVSVFGMMLFSGCSSQIKDDNLVLDHEWKPDIYNLIISHVSDADNLRFWVRRTPSYEDGYPHQLACVEVSQPLEPNRFYIANLNTYGLNEVYNCEDDYWRHNNLVDPYKSRVVDLSAWDPKLSKHRYKSYPVNMNTDIDGVDAYLLGQGQLRLVFSDLFPVNQYQLTNSGVKTLFDVLDKLKYLPVEELTIYGVADSSGSYQKNRVLSDRRAQSVKTFLVEEGLSYLPMKLRGTVENGLSTAQQRVLQRRFIIEVRFKTDGK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.46 | 2.4e-6 | ●●●●● -4.95 | -4.9492193437115075 | 27185914 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)