Bacterial taxon 223926
Locus VPA_1362
Protein BAC62705.1
putative secreted protein EspD
Vibrio parahaemolyticus RIMD 2210633
Length 349 aa, Gene n/a, UniProt Q87GF4
>BAC62705.1|Vibrio parahaemolyticus RIMD 2210633|putative secreted protein EspD
MKTSLVNIAENQESLWGQANKEIEKKQNQPQQQAESGSVVPGQPLPGSSVSLNDLWRSIRESMKQVADSVSGSGQEKVATKKGLIELQKDSQIAMLNERASQLEEQKKAQQTQGILGKIAMAFGFIAAIIMAPFNPVMAAVMIGGMVASLVIPKIADEIMKSAGVDEKTRGIVKMGLDIAIGLGTMLLSFNPAGIASSAGKAIAGGAAKAAALVKRGVDAAKTLKSFTAISSKAGGLAEKIRKSAQPLLDKIQEFAKGGQMSAARIGQASSVGSNVTSLVSTGYGIKTADISKQMEVNQAKQDELQTRIEQVLKMLDQAMRSVAHSFETLIKTNEDYRSFSKTMTSIHM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.81 | 2.6e-7 | ●●●●● -5.38 | -5.3794663396713664 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)