Bacterial taxon 223926
Locus VPA_1341
Protein BAC62684.1
putative Spa29, component of the Mxi-Spa secretion machinery
Vibrio parahaemolyticus RIMD 2210633
Length 227 aa, Gene n/a, UniProt Q87GH5
>BAC62684.1|Vibrio parahaemolyticus RIMD 2210633|putative Spa29, component of the Mxi-Spa secretion machinery
MQQILFPNWMLFAGFYLFLRIFNPTRLYLDNTSSLAIAIMLAIGLEREHLAQPATLLWVIAAVTFAFVCSVPYWLSGIVGCVLQQMLLLNEQSVQDHRFTDESEALAKLCSLVFVAYALENGAVFKPLFDLILSRHLVLPEVSFSSLYQTVVENMQMILIISGKYIILMLVITMCCGYLDLFFKKASLSMFVTPNIKSIVIVILLNIWLFHDQFYVFNKMMKSLGYE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.68 | 0.00017 | ●●●●○ -3.99 | -3.98953027190144 | 27185914 |
Retrieved 1 of 1 entries in 138.5 ms
(Link to these results)