Bacterial taxon 223926
Locus VPA_1219
Protein BAC62562.1
putative transcription regulator
Vibrio parahaemolyticus RIMD 2210633
Length 154 aa, Gene n/a, UniProt Q87GU6
>BAC62562.1|Vibrio parahaemolyticus RIMD 2210633|putative transcription regulator
MHLMIQDINILRDLSLAEKLSRVARLWKMVADRELEPLNLTYPRWTALWKLYRMGDNISQKQLAEALEIELASLMRTLKLLEEQSLVTRRCCEHDKRARIVSLTDEGKELLIQMEERILQVRRKLLSEINDQELKKLGLILEQIAHNALDSLGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.65 | 0.012 | ●●●○○ -2.73 | -2.730012941440477 | 27185914 |
Retrieved 1 of 1 entries in 60.3 ms
(Link to these results)