Bacterial taxon 223926
Locus VPA_1562
Protein BAC62905.1
putative transcriptional regulator
Vibrio parahaemolyticus RIMD 2210633
Length 181 aa, Gene n/a, UniProt Q87FW6
>BAC62905.1|Vibrio parahaemolyticus RIMD 2210633|putative transcriptional regulator
MNKKKQLLIDTALSLFYKQGINSIGINEVLKVSGVAKRTLYSHFESKEALILAALEQRHQIFMAWLEEKLSSAQSSTDVIDQLFTALSGWFHGSEEKLGEFRGCFFINTSAEFSDDSGEIATYCRHHKQQVRELIQRYLKSDNTSLLDAICIMKEGAITTAYMTKEYDDVTKKCVEILHKL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.25 | 0.04 | ●●●○○ -2.24 | -2.238412636626636 | 27185914 |
Retrieved 1 of 1 entries in 1629.9 ms
(Link to these results)