Bacterial taxon 223926
Locus VPA_1365
Protein BAC62708.1
putative two-component response regulator
Vibrio parahaemolyticus RIMD 2210633
Length 162 aa, Gene n/a, UniProt Q87GF1
>BAC62708.1|Vibrio parahaemolyticus RIMD 2210633|putative two-component response regulator
MSEFEIEVDKLSEDFFELLEGKVIDEHINKIKKEKKVTIEILKELLDLGDAHYQKYQLKEAEIVYLSYTGLCPFDHRGPASLASIYLEQAQFQKALDMLNIVKTYPTADFDETLVNMALCHYKLKQYIEAAAVFIIIKSEKLNEFNQKRYDFLRKQLNPYLI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -5.16 | 2.4e-8 | ●●●●● -5.8 | -5.803040523343145 | 27185914 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)