Bacterial taxon 223926
Locus VP_0588
Protein BAC58851.1
queuine tRNA-ribosyltransferase
Vibrio parahaemolyticus RIMD 2210633
Length 377 aa, Gene tgt, UniProt Q87S36
>BAC58851.1|Vibrio parahaemolyticus RIMD 2210633|queuine tRNA-ribosyltransferase
MKLKFDLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQEVMKMHGDLHDFMNWHGPILTDSGGFQVFSLGKMRTITEKGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHNEAKKSMEMSLRWAQRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAKHKTDTTPLDPHCDCYTCQNYSKSYLHHLERCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDEFVQEFYARRDREVPPLSKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.85 | 0.0033 | ●●●●○ -3.05 | -3.0517742059625297 | 27185914 |
Retrieved 1 of 1 entries in 17.5 ms
(Link to these results)