Bacterial taxon 223926
Locus VP_0283
Protein BAC58546.1
ribosomal protein L17
Vibrio parahaemolyticus RIMD 2210633
Length 126 aa, Gene rplQ, UniProt Q87SY9
>BAC58546.1|Vibrio parahaemolyticus RIMD 2210633|ribosomal protein L17
MRHRKSGRQLNRNSSHRKAMFSNMASSLVRHEVIKTTLPKAKELRRVVEPLITLAKTDSVANRRLAFARTRDNEVVAKLFNELGPRFAARQGGYTRILKAGFRAGDKAPMAYIELVDRPAAEEAAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.52 | 0.0076 | ●●●○○ -2.76 | -2.763516699949951 | 27185914 |
Retrieved 1 of 1 entries in 120.4 ms
(Link to these results)