Bacterial taxon 223926
Locus VP_2741
Protein BAC61004.1
ribulose-phosphate 3-epimerase
Vibrio parahaemolyticus RIMD 2210633
Length 223 aa, Gene n/a, UniProt Q87L71
>BAC61004.1|Vibrio parahaemolyticus RIMD 2210633|ribulose-phosphate 3-epimerase
MKDFLIAPSILSADFARLGEDVEKVLAAGADVVHFDVMDNHYVPNLTFGAPVCKALRDYGITAPIDVHLMVKPVDRIIPDFAKAGASMITFHVEASDHVDRTLQLIKEHGCKAGVVLNPATPLAHLEFIMDKVDLILLMSVNPGFGGQSFIPHTLDKLRAVRKMIDESGRDIRLEIDGGVKVDNIREIAEAGADMFVAGSAIFGQLDYKQVIDQMRTELAQVE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.34 | 0.012 | ●●●○○ -2.61 | -2.6070324324729275 | 27185914 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)