Bacterial taxon 223926
Locus VP_2578
Protein BAC60841.1
RNA polymerase sigma-E factor
Vibrio parahaemolyticus RIMD 2210633
Length 192 aa, Gene n/a, UniProt Q87LN3
>BAC60841.1|Vibrio parahaemolyticus RIMD 2210633|RNA polymerase sigma-E factor
MNEQLTDQVLIERVQNGDKQAFNLLVTKYQNKVCNLISRYVSNPGDVPDVAQEAFIKAYRAIPSFRGESAFYTWLYRIAVNTAKNHIVAQGRRPPATDVDAEEAEFYETGSALKEISNPENLTLSKELQRVVFSAIEALPEDLKTAMTLRELDGLSYEEIAEVMDCPVGTVRSRIFRAREAVEKKIKPLLQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.55 | 0.0071 | ●●●○○ -2.79 | -2.7889017237518776 | 27185914 |
Retrieved 1 of 1 entries in 24.1 ms
(Link to these results)