Bacterial taxon 223926
Locus VP_0838
Protein BAC59101.1
SeqA protein
Vibrio parahaemolyticus RIMD 2210633
Length 180 aa, Gene seqA, UniProt Q87RF9
>BAC59101.1|Vibrio parahaemolyticus RIMD 2210633|SeqA protein
MKTIEVDEDLYRYIASQTKHIGESASDILRRLLNLDGQLQVAESAPAVEKPQGIVVSKDAGKAESIDVVKEMRSLLISDEFAGLKKAIDRFMLVLSTLHKLNPEGFAQATNVKGRKRVYFADNEETLLANGNTTKPKAIPGTPFWVITNNNTSRKRQMVEQVMTHMEFQPDLIEKVTGSI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.38 | 0.00073 | ●●●●○ -3.51 | -3.5101977972924825 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)