Bacterial taxon 223926
Locus VP_0846
Protein BAC59109.1
succinate dehydrogenase, iron-sulfur protein
Vibrio parahaemolyticus RIMD 2210633
Length 236 aa, Gene n/a, UniProt Q87RF1
>BAC59109.1|Vibrio parahaemolyticus RIMD 2210633|succinate dehydrogenase, iron-sulfur protein
MKLNFSLYRYNPDVDTKPYMKEYTLEVDEGSDMMVLDALILLKEQDPSIAFRRSCREGVCGSDGLNMNGKNGLACITPLSALQGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLIDDGALPPSRENLQSPDERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWLIDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLVNRSV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.97 | 0.025 | ●●●○○ -2.29 | -2.2879172994204735 | 27185914 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)