Bacterial taxon 223926
Locus VP_3001
Protein BAC61264.1
thioredoxin
Vibrio parahaemolyticus RIMD 2210633
Length 108 aa, Gene n/a, UniProt Q87KH6
>BAC61264.1|Vibrio parahaemolyticus RIMD 2210633|thioredoxin
MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEIAEEYEGKLTIGKLNIDHNAGTPPKFGIRGIPTLLLFKDGNVAATKVGALSKTQLKEFLDANL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.19 | 0.016 | ●●●○○ -2.47 | -2.4743383210903116 | 27185914 |
Retrieved 1 of 1 entries in 2.9 ms
(Link to these results)