Bacterial taxon 223926
Locus VPA_0662
Protein BAC62004.1
transcriptional regulator, MerR family
Vibrio parahaemolyticus RIMD 2210633
Length 128 aa, Gene n/a, UniProt Q87IE5
>BAC62004.1|Vibrio parahaemolyticus RIMD 2210633|transcriptional regulator, MerR family
MNIGAVAKLTGLSSKSIRLYEDKGIISPPARSDSGYREYSDNHIQELNLVSRAKNAGFSLQECKEFVQLAHNPNRKSSEVKERTMDKLREVEEKIAHLMEIKKQLEGWVSACPGDAKSRCPIIDELTK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.89 | 0.0052 | ●●●●○ -3.02 | -3.0166423139562135 | 27185914 |
Retrieved 1 of 1 entries in 99.9 ms
(Link to these results)