Bacterial taxon 223926
Locus VP_2190
Protein BAC60453.1
tRNA pseudouridine synthase A
Vibrio parahaemolyticus RIMD 2210633
Length 264 aa, Gene truA, UniProt Q87MP1
>BAC60453.1|Vibrio parahaemolyticus RIMD 2210633|tRNA pseudouridine synthase A
MRIALGIEYNGTNYFGWQRQREVKSVQEELEKALSIVANHPVEVQCAGRTDAGVHGTGQVVHFDTNVNRKMVAWTMGANANMPSDIAVRWAKEVPDDFHARFSATARRYRYIIFNHALRPGILNSGVSHYHGELDEKKMHEAGQYLLGENDFSSFRAAHCQSLSPCRNLMHLNVTRHGDYVVIDIKANAFVHHMVRNITGSLIKVGRGEEKPEWIKWLLEAKDRKLAGATAKAEGLYLVDVDYPEEFELPCVPIGPLFLPDNLN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.91 | 0.00013 | ●●●●○ -3.98 | -3.97551880184839 | 27185914 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)